
LL-37: Antimicrobial Peptide Mechanism & Research Overview
A comprehensive review of LL-37 (Cathelicidin), covering its role in innate immunity, antimicrobial mechanisms, and research applications.
LL-37: Antimicrobial Peptide Mechanism & Research Overview
Key Points
- LL-37 is the only human cathelicidin antimicrobial peptide, consisting of 37 amino acids beginning with two leucine residues
- Molecular formula: C205H340N60O53 with a molecular weight of approximately 4493.33 g/mol
- Endogenously produced by neutrophils, epithelial cells, and macrophages as part of innate immune defense
- Research indicates broad-spectrum antimicrobial activity through membrane disruption mechanisms
- Additional documented activities include immunomodulation, wound healing promotion, and angiogenesis effects
- Not approved as a therapeutic agent; remains an active area of antimicrobial peptide research
Table of Contents
- Introduction
- Molecular Structure
- Mechanism of Action
- Research Overview
- Comparison to KPV Peptide
- Disease Associations
- Stability & Handling
- Current Research Limitations
- Conclusion
- References
Introduction
LL-37 is the sole member of the cathelicidin family of antimicrobial peptides expressed in humans. Named for its 37 amino acid length and the two leucine (L) residues at its N-terminus, LL-37 represents a critical component of the innate immune system's first line of defense against microbial pathogens.
The peptide is derived from the 18 kDa precursor protein human cationic antimicrobial protein (hCAP18), which is encoded by the CAMP gene located on chromosome 3. Upon activation of innate immune responses, hCAP18 is cleaved by proteinase 3 in neutrophils or by kallikreins in keratinocytes to release the mature, bioactive LL-37 peptide.
First characterized in the 1990s by Gudmundsson and colleagues, LL-37 has since become one of the most extensively studied human antimicrobial peptides. Its expression occurs in numerous cell types and tissues, including neutrophils (where it is stored in specific granules), monocytes, macrophages, natural killer cells, mast cells, and various epithelial surfaces including skin, respiratory tract, gastrointestinal tract, and urogenital mucosa.
Beyond its direct antimicrobial functions, research has revealed that LL-37 participates in diverse immunological processes including chemotaxis, cytokine modulation, wound healing, and angiogenesis. This multifunctionality has positioned LL-37 as a central player in host defense and has generated substantial research interest in understanding its mechanisms and potential applications.
This article provides an objective examination of LL-37 biology, documented mechanisms, and current research findings, emphasizing its role as an endogenous immune effector molecule while reviewing the scientific literature on its various activities.
Molecular Structure
Chemical Properties
| Property | Value |
|---|---|
| Molecular Formula | C205H340N60O53 |
| Molecular Weight | 4493.33 g/mol |
| Sequence | [LL-37, 37 aa] |
| Amino Acid Count | 37 |
| Net Charge (pH 7) | +6 |
| Isoelectric Point | ~10.6 |
| Precursor Protein | hCAP18 (human Cationic Antimicrobial Protein 18) |
| Gene | CAMP (Cathelicidin Antimicrobial Peptide) |
Structural Characteristics
LL-37 exhibits an amphipathic alpha-helical structure when associated with lipid membranes or membrane-mimetic environments. In aqueous solution, the peptide adopts a largely disordered conformation, but upon contact with bacterial membranes or lipid bilayers, it undergoes a conformational transition to an alpha-helix spanning approximately residues 2-31.
The amphipathic nature of LL-37 is central to its biological activity. The alpha-helix presents a hydrophobic face containing residues such as phenylalanine (F), leucine (L), and isoleucine (I), while the opposite face displays positively charged residues including lysine (K) and arginine (R). This arrangement enables the peptide to interact electrostatically with negatively charged bacterial membranes while inserting hydrophobic residues into the lipid bilayer.
Key structural features include:
- N-terminal Region (residues 1-12): Contains the LL dipeptide signature and contributes to membrane binding
- Central Core (residues 13-31): Primary alpha-helical region responsible for membrane interaction and disruption
- C-terminal Region (residues 32-37): More flexible tail region with reduced helical propensity
Post-translational Processing
The generation of mature LL-37 involves proteolytic processing of the hCAP18 precursor:
- Biosynthesis: hCAP18 is synthesized as a 170-amino acid preproprotein
- Signal Peptide Removal: A 30-residue signal peptide is cleaved during secretion
- Cathelin Domain: The 99-residue cathelin-like domain remains attached until activation
- Final Cleavage: Proteinase 3 (neutrophils) or kallikreins (keratinocytes) release LL-37
Research has also identified additional processing products, including shorter fragments such as LL-29 and KS-30, which may have distinct biological activities. The precise physiological significance of these alternative forms remains under investigation.
Mechanism of Action
LL-37 exerts its biological effects through multiple mechanisms, reflecting its evolution as a multifunctional host defense molecule. Research has documented both direct antimicrobial activities and indirect immunomodulatory functions.
Membrane Disruption
The primary antimicrobial mechanism of LL-37 involves direct interaction with and disruption of microbial membranes. This process occurs through several proposed models:
Barrel-Stave Model
- LL-37 molecules insert perpendicular to the membrane surface
- Hydrophobic faces interact with lipid acyl chains
- Hydrophilic faces line a central aqueous pore
- Results in discrete transmembrane channels
Toroidal Pore Model
- Peptides induce membrane curvature
- Lipid head groups bend to line the pore along with peptides
- Creates transient pores with mixed peptide-lipid composition
- Currently considered the predominant mechanism for LL-37
Carpet Model
- Peptides accumulate parallel to membrane surface
- Electrostatic interactions with anionic lipid head groups
- At threshold concentration, membrane integrity is compromised
- Results in micelle formation and membrane solubilization
The selectivity of LL-37 for bacterial over mammalian membranes derives from compositional differences:
- Bacterial membranes contain high proportions of anionic phospholipids (phosphatidylglycerol, cardiolipin)
- Mammalian cell membranes have predominantly zwitterionic phospholipids and cholesterol
- The cationic nature of LL-37 preferentially targets anionic bacterial surfaces
Immunomodulatory Activities
Beyond direct killing, LL-37 modulates immune responses through multiple pathways:
Chemotaxis and Cell Recruitment
- Acts as chemoattractant for neutrophils, monocytes, and T cells
- Signals through formyl peptide receptor-like 1 (FPRL1/FPR2)
- Promotes immune cell migration to sites of infection
Cytokine Modulation
- Influences production of pro-inflammatory and anti-inflammatory cytokines
- Can both enhance and suppress cytokine responses depending on context
- Modulates IL-1beta, TNF-alpha, IL-6, and IL-10 production
Toll-Like Receptor Interactions
- Binds and sequesters lipopolysaccharide (LPS), preventing TLR4 activation
- Modulates TLR signaling in dendritic cells and macrophages
- May reduce excessive inflammatory responses to bacterial products
Mast Cell Activation
- Induces mast cell degranulation and histamine release
- Promotes prostaglandin D2 production
- May contribute to allergic inflammation in some contexts
Wound Healing Promotion
Research indicates LL-37 participates in tissue repair processes:
- Re-epithelialization: Promotes keratinocyte migration and proliferation
- Angiogenesis: Stimulates endothelial cell proliferation and tube formation
- Growth Factor Transactivation: Activates EGFR signaling pathways
- Extracellular Matrix Interactions: Modulates matrix metalloproteinase activity
Studies by Heilborn et al. demonstrated reduced LL-37 expression in chronic, non-healing wounds compared to acute wounds, suggesting a role in normal healing progression.
Anti-Biofilm Activity
LL-37 has demonstrated activity against bacterial biofilms:
- Inhibits initial biofilm formation at sub-inhibitory concentrations
- Disrupts established biofilm structures
- Reduces bacterial attachment to surfaces
- May penetrate biofilm matrix to access embedded bacteria
This property is particularly relevant given the clinical challenges posed by biofilm-associated infections.
Research Overview
Infectious Disease Research
Bacterial Infections LL-37 demonstrates broad-spectrum activity against gram-positive and gram-negative bacteria:
- Staphylococcus aureus (including MRSA strains) - MIC values ranging from 4-32 micrograms/mL
- Escherichia coli - Direct killing and LPS neutralization documented
- Pseudomonas aeruginosa - Both planktonic and biofilm activity observed
- Streptococcus species - Activity against respiratory and skin pathogens
- Mycobacterium tuberculosis - Research suggests activity against intracellular bacteria
Viral Infections Emerging research indicates antiviral properties:
- Documented activity against enveloped viruses (HSV, HIV, influenza)
- Proposed mechanisms include direct virucidal effects and interference with viral entry
- May modulate antiviral immune responses through immunomodulatory activities
Fungal Infections Studies demonstrate activity against common fungal pathogens:
- Candida albicans - Direct killing and biofilm inhibition
- Aspergillus fumigatus - Membrane disruption mechanisms confirmed
- May synergize with conventional antifungal agents
Wound Healing Studies
Research has examined LL-37's role in tissue repair:
In Vitro Studies
- Enhanced keratinocyte migration in scratch assay models
- Increased endothelial cell proliferation and tube formation
- EGFR-dependent signaling pathways identified
- Dose-dependent effects on cell migration observed
Animal Model Research
- Accelerated wound closure in diabetic mouse models
- Enhanced angiogenesis in wound beds
- Improved granulation tissue formation
- Modified inflammatory cell infiltration patterns
Clinical Observations
- Reduced LL-37 expression documented in chronic wounds
- Correlation between LL-37 levels and healing outcomes
- Expression patterns differ between healing and non-healing ulcers
Cancer Research
LL-37's effects in cancer contexts have yielded complex findings:
Anti-tumor Observations
- Direct cytotoxicity against certain cancer cell lines
- Immunomodulatory effects may enhance anti-tumor immunity
- Documented activity against hematological malignancies in vitro
Pro-tumor Concerns
- LL-37 overexpression observed in some tumor types
- May promote tumor angiogenesis in certain contexts
- EGFR transactivation could theoretically support tumor cell proliferation
This dual nature underscores the complexity of LL-37 biology and the need for careful investigation in oncological contexts.
Inflammatory Disease Research
Inflammatory Bowel Disease
- Expression patterns studied in Crohn's disease and ulcerative colitis
- May influence gut barrier function and mucosal immunity
- Research examines both protective and potentially harmful roles
Respiratory Inflammation
- Elevated levels in cystic fibrosis airway secretions
- Role in asthma pathophysiology under investigation
- May modulate airway epithelial responses to pathogens
Comparison to KPV Peptide
Both LL-37 and KPV are endogenous peptides with immunomodulatory properties, but they differ substantially in structure, mechanism, and research applications.
Structural Differences
| Feature | LL-37 | KPV |
|---|---|---|
| Size | 37 amino acids | 3 amino acids |
| Molecular Weight | 4493.33 g/mol | 342.43 g/mol |
| Charge | +6 (cationic) | ~+1 |
| Structure | Alpha-helical | Linear tripeptide |
| Parent Molecule | hCAP18 | Alpha-MSH |
Mechanistic Distinctions
LL-37:
- Direct antimicrobial activity via membrane disruption
- Broad immunomodulatory effects through multiple receptors
- FPRL1/FPR2 receptor interactions documented
- Amphipathic membrane-active mechanism
KPV:
- Primarily anti-inflammatory via NF-kB inhibition
- No significant direct antimicrobial activity at physiological concentrations
- Melanocortin receptor-independent mechanism
- PepT1 transporter-mediated cellular uptake
Research Applications
LL-37 Focus Areas:
- Antimicrobial peptide development
- Host defense peptide biology
- Wound healing mechanisms
- Infectious disease research
KPV Focus Areas:
- Anti-inflammatory mechanisms
- Inflammatory bowel disease models
- Skin inflammation research
- NF-kB pathway studies
Complementary Potential
Research suggests potential complementarity between antimicrobial and anti-inflammatory mechanisms in managing infections with inflammatory components. However, combination studies remain limited, and any synergistic potential requires experimental validation.
Disease Associations
LL-37 Deficiency States
Reduced LL-37 expression or function has been associated with increased susceptibility to various conditions:
Chronic Wounds
- Non-healing wounds show diminished LL-37 expression
- Diabetic ulcers demonstrate reduced cathelicidin levels
- Impaired LL-37 induction may contribute to healing failure
Kostmann Syndrome
- Severe congenital neutropenia with neutrophil LL-37 deficiency
- Patients exhibit increased susceptibility to severe infections
- Periodontal disease and oral infections common
- Demonstrates physiological importance of LL-37 in host defense
Atopic Dermatitis
- Reduced LL-37 expression in lesional skin
- May contribute to increased susceptibility to skin infections
- S. aureus colonization rates elevated
- Contrast with psoriasis where LL-37 is overexpressed
Burn Wounds
- LL-37 levels decreased in burn patients
- Correlates with infection susceptibility
- Expression may predict infectious complications
LL-37 Excess and Overexpression
Elevated LL-37 has been associated with inflammatory pathology:
Psoriasis
- Marked overexpression in psoriatic lesions
- LL-37 complexes with self-DNA to activate dendritic cells
- Triggers TLR9-mediated interferon-alpha production
- May break tolerance to self-nucleic acids
Rosacea
- Elevated LL-37 and altered processing documented
- Abnormal cathelicidin fragments detected
- May contribute to inflammatory vascular changes
- Kallikrein 5-mediated aberrant processing identified
Atherosclerosis
- LL-37 detected in atherosclerotic plaques
- May influence macrophage foam cell formation
- Role in plaque inflammation under investigation
Systemic Lupus Erythematosus
- LL-37-DNA complexes may drive autoimmune responses
- Similar mechanism to psoriasis pathogenesis
- Interferon-alpha pathway activation implicated
Implications for Research
The disease associations highlight LL-37's dual nature:
- Deficiency increases infection susceptibility
- Excess may drive inflammatory pathology
- Optimal LL-37 activity requires precise regulation
- Research applications must consider context-dependent effects
Stability & Handling
Storage Requirements
| Condition | Recommendation |
|---|---|
| Lyophilized Form | -20C to -80C, protected from light and moisture, stable 2+ years |
| Reconstituted (Bacteriostatic Water) | 2-8C, use within 2 weeks |
| Reconstituted (Sterile Water) | 2-8C, use within 3-5 days |
| Working Solutions | Prepare fresh daily for sensitive applications |
Reconstitution Guidelines
For research applications:
- Allow lyophilized peptide to equilibrate to room temperature before opening (prevents condensation)
- Reconstitute in sterile water, PBS, or appropriate buffer depending on application
- Add solvent slowly along vial wall to prevent foaming (LL-37 is surface-active)
- Swirl gently until completely dissolved; avoid vigorous vortexing
- Filter through 0.22 micrometer filter if sterility required
- Prepare small aliquots to minimize freeze-thaw cycles
- Document concentration, date, and storage conditions
Stability Considerations
LL-37 presents specific stability challenges:
Aggregation Propensity
- Amphipathic nature promotes self-association at high concentrations
- May form oligomers that affect activity measurements
- Keep working concentrations appropriate for intended assay
Surface Adsorption
- Cationic, hydrophobic peptide adheres to plastic and glass surfaces
- Use low-binding plasticware when possible
- Include carrier protein (BSA) or detergent in dilute solutions
- Account for potential losses in serial dilutions
Proteolytic Degradation
- Susceptible to serum proteases
- Include protease inhibitors in biological samples
- Plasma half-life is limited (minutes)
pH Sensitivity
- Stable across pH 4-8
- Extreme pH may affect helical conformation
- Buffer pH according to experimental requirements
Salt Concentration Effects
- High ionic strength can reduce antimicrobial activity
- Physiological salt concentrations partially inhibit bacterial killing
- Consider salt effects when designing antimicrobial assays
Current Research Limitations
Study Design Considerations
Critical evaluation of LL-37 research reveals several important limitations:
-
In Vitro vs. In Vivo Discrepancies: Many antimicrobial assays use non-physiological conditions; activity may differ substantially in biological environments with serum, salt, and proteases present
-
Concentration Variability: Studies employ widely varying LL-37 concentrations, complicating comparisons; physiological concentrations in tissues are often poorly defined
-
Purity and Source Variation: Commercial peptide quality varies; minor impurities or truncation products may affect results
-
Animal Model Translation: Mice express the ortholog CRAMP (cathelicidin-related antimicrobial peptide), which differs from human LL-37 in sequence and potentially function
-
Pleiotropic Effects: Multiple simultaneous activities make it difficult to isolate specific mechanisms in complex experimental systems
Clinical Development Challenges
Several obstacles complicate translation to therapeutic applications:
- Proteolytic Instability: Rapid degradation limits systemic application
- Manufacturing Complexity: 37-amino acid peptide with correct folding requirements
- Toxicity at High Concentrations: Potential for hemolysis and mammalian cell toxicity
- Immunogenicity Concerns: Potential for antibody development with repeated administration
- Delivery Challenges: Achieving effective concentrations at infection sites
Areas Requiring Further Investigation
- Detailed pharmacokinetic and pharmacodynamic profiling
- Optimized derivatives with improved stability and selectivity
- Understanding of context-dependent pro-inflammatory versus anti-inflammatory effects
- Long-term safety assessment in relevant animal models
- Validated biomarkers for clinical studies
- Standardized activity assays for research consistency
Human Research Status
As of 2026, LL-37 and derivative peptides remain in developmental stages:
- Limited clinical trials completed for specific applications
- No FDA-approved therapeutic products
- Several LL-37-derived candidates in preclinical or early clinical development
- Topical applications more advanced than systemic approaches
- Research compound status for investigational use
Conclusion
LL-37 represents a remarkable example of the human innate immune system's sophistication. As the only human cathelicidin, this 37-amino acid peptide serves multiple functions in host defense, from direct pathogen killing through membrane disruption to complex immunomodulatory activities that shape both innate and adaptive immune responses.
The endogenous nature of LL-37 distinguishes it from synthetic antimicrobial agents. Its expression by diverse cell types, regulated production in response to infection and inflammation, and integration with other immune mechanisms reflect evolutionary optimization for host protection. The documented disease associations with both deficiency and excess states underscore the importance of precisely regulated LL-37 activity.
Research over the past three decades has substantially advanced understanding of LL-37 biology. The structural basis for its amphipathic, membrane-disrupting activity is well characterized, and multiple immunomodulatory pathways have been identified. Studies in infectious disease, wound healing, and inflammatory conditions have revealed both promising activities and cautionary complexities.
However, significant gaps remain between mechanistic understanding and clinical application. The challenges of proteolytic stability, potential toxicity, and context-dependent effects require continued investigation. The dual capacity of LL-37 to both promote beneficial immunity and drive pathological inflammation demands careful consideration in any therapeutic development program.
For researchers, LL-37 provides a valuable tool for investigating host defense mechanisms, antimicrobial peptide biology, and innate immunity. Its comparison with other immunomodulatory peptides such as KPV highlights the diverse strategies evolution has produced for host protection and immune regulation.
As antimicrobial resistance continues to challenge conventional antibiotics, host defense peptides like LL-37 represent an important area of ongoing investigation. Whether through direct development of LL-37-based therapeutics or through insights gained from studying this natural immune effector, research on human cathelicidin contributes to our understanding of host defense and potential future interventions.
References
-
Zanetti M. Cathelicidins, multifunctional peptides of the innate immunity. J Leukoc Biol. 2004;75(1):39-48. doi:10.1189/jlb.0403147
-
Durr UH, Sudheendra US, Ramamoorthy A. LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochim Biophys Acta. 2006;1758(9):1408-1425. doi:10.1016/j.bbamem.2006.03.030
-
Vandamme D, Lanber B, Vergote V, et al. Human cathelicidin LL-37: structure, function, and mechanisms. Cell Mol Life Sci. 2012;69(13):2051-2063. doi:10.1007/s00018-012-0949-5
-
Gudmundsson GH, Agerberth B, Odeberg J, et al. The human gene FALL39 and processing of the cathelin precursor to the antibacterial peptide LL-37 in granulocytes. Eur J Biochem. 1996;238(2):325-332. doi:10.1111/j.1432-1033.1996.0325z.x
-
Sorensen OE, Follin P, Johnsen AH, et al. Human cathelicidin, hCAP-18, is processed to the antimicrobial peptide LL-37 by extracellular cleavage with proteinase 3. Blood. 2001;97(12):3951-3959. doi:10.1182/blood.V97.12.3951
-
Oren Z, Lerman JC, Gudmundsson GH, et al. Structure and organization of the human antimicrobial peptide LL-37 in phospholipid membranes: relevance to the molecular basis for its non-cell-selective activity. Biochem J. 1999;341(Pt 3):501-513.
-
Yang D, Chen Q, Schmidt AP, et al. LL-37, the neutrophil granule- and epithelial cell-derived cathelicidin, utilizes formyl peptide receptor-like 1 (FPRL1) as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T cells. J Exp Med. 2000;192(7):1069-1074. doi:10.1084/jem.192.7.1069
-
Mookherjee N, Brown KL, Bowdish DM, et al. Modulation of the TLR-mediated inflammatory response by the endogenous human host defense peptide LL-37. J Immunol. 2006;176(4):2455-2464. doi:10.4049/jimmunol.176.4.2455
-
Heilborn JD, Nilsson MF, Kratz G, et al. The cathelicidin anti-microbial peptide LL-37 is involved in re-epithelialization of human skin wounds and is lacking in chronic ulcer epithelium. J Invest Dermatol. 2003;120(3):379-389. doi:10.1046/j.1523-1747.2003.12069.x
-
Koczulla R, von Degenfeld G, Kupatt C, et al. An angiogenic role for the human peptide antibiotic LL-37/hCAP-18. J Clin Invest. 2003;111(11):1665-1672. doi:10.1172/JCI17545
-
Lande R, Gregorio J, Facchinetti V, et al. Plasmacytoid dendritic cells sense self-DNA coupled with antimicrobial peptide. Nature. 2007;449(7162):564-569. doi:10.1038/nature06116
-
Yamasaki K, Di Nardo A, Bardan A, et al. Increased serine protease activity and cathelicidin promotes skin inflammation in rosacea. Nat Med. 2007;13(8):975-980. doi:10.1038/nm1616
-
Putsep K, Carlsson G, Boman HG, Andersson M. Deficiency of antibacterial peptides in patients with morbus Kostmann: an observation study. Lancet. 2002;360(9340):1144-1149. doi:10.1016/S0140-6736(02)11201-3
-
Ong PY, Ohtake T, Brandt C, et al. Endogenous antimicrobial peptides and skin infections in atopic dermatitis. N Engl J Med. 2002;347(15):1151-1160. doi:10.1056/NEJMoa021481
-
Overhage J, Campisano A, Bains M, et al. Human host defense peptide LL-37 prevents bacterial biofilm formation. Infect Immun. 2008;76(9):4176-4182. doi:10.1128/IAI.00318-08
-
Barns KJ, Weisshaar JC. Real-time attack of LL-37 on single Bacillus subtilis cells. Biochim Biophys Acta. 2013;1828(6):1511-1520. doi:10.1016/j.bbamem.2013.02.011
-
Wang TT, Nestel FP, Bourdeau V, et al. Cutting edge: 1,25-dihydroxyvitamin D3 is a direct inducer of antimicrobial peptide gene expression. J Immunol. 2004;173(5):2909-2912. doi:10.4049/jimmunol.173.5.2909
Reviewed by: Dr. Research Reviewer, PhD